Look through the key statistics analysis before diving in deeper into our report:
Parameter | Current result | Assessment |
---|---|---|
Meta title | wishart village family practice | As meta title is a ranking factor, it's quite important to stick to search engine recommended length of aroun 50-60 characters. This website's meta title is 31 characters long. |
Description | MEDICAL CENTRE OFFERING FAMILY MEDICINE, VACCINES, MEDICALS,baby checks,pathology and allied health ie: physiotherapy, psychology, podiatry dietitian | This meta description is 149 characters in length. Google suggests up to 320 characters at the very most to make sure the whole meta description is visible in search results page. |
<meta> keywords | VACCINATIONS, IMMUNISATIONS, MEDICAL, TRAVEL VACCINES,DOCTOR, FAMILY DOCTOR,physiotherapist, podiatrist, psychologist, dietitian | Strangely enough, meta keywords still seem to be used. We would not go down that road unless very carefully - meta keywords have not been known as a positive ranking factor for a while now. |
Site speed | Around 1.0416 seconds | The website load speed is rather good. |
Links on homepage | Around 12 links | This is a well-judged amount of links for a homepage. |
Backlinks amount | Approximately 1 | The number of backlinks seems awfully low. If possible, the webmaster should work towards building more through quality content and public awareness. |
HTML size | 44.6KB | A very good result, this. Remember, search engines such as Google place a lot of their website ratings on its speed. |
Website host server overview | Server status: online. Server IP address for this website is 64.34.68.10. | We apologize, but for some reason we were unable to gather enough data to provide a detailed insight at this time. |
If the basic information we presented you with above is not enough, get ready to dive in much deeper!
Now that the numbers are taken care of, we can go deeper and try to analyse the website from a user's perspective. More specifically, let's see if we can identify the target audience as well as a few related websites and categories.
Parameter | Current result | Assessment |
---|---|---|
Alternative websites | bennefit.com.au activecarephysio.com.au optimisenutrition.com.au roomsbayside.com wishartmedicalcentre.com.au |
These websites fall into the same categories as wishartvillagefamilypractice.com.au, more or less. By extension, they compete with the analysed website for the same target audience. |
Servers are physical storage devices that contain all the files and databases associated with a specific website, sometimes more than one. At times, a server makes up several virtual devices - separate servers used for shared hosting (tends to be cheaper). Entering website address into the address bar of your browser starts the request process during which your browser contacts the server and asks for specific files and database entries in order to display the requested website.
What follows is certainly very geeky, but informative for the knowing. Dig in:
Header detail |
---|
HTTP/1.1 200 OK Date: Mon, 27 Nov 2017 20:15:34 GMT Server: Apache Cache-Control: public, max-age=60 Last-Modified: Wed, 18 Oct 2017 23:34:59 GMT Transfer-Encoding: chunked Content-Type: text/html; charset=utf-8 |
Now that you are hopefully done with wishartvillagefamilypractice.com.au, we invite you to read more of our in-depth reports. Try entering a new domain address in the search form at the top of this page, or on the homepage. Alternatively, refer to this list for more website overviews:
We have found so many alternative TLD extensions for wishartvillagefamilypractice.com.au. Here is the full list with 580 entries:
The following list of most frequent domain address mistypes associated with wishartvillagefamilypractice.com.au contains at least 1626 entries: