Look through the key statistics analysis before diving in deeper into our report:
Parameter | Current result | Assessment |
---|---|---|
Meta title | Site Ekle Firma Ekle Site Kaydet , Web Kuyusu'nda Yerinizi Alın | As meta title is a ranking factor, it's quite important to stick to search engine recommended length of aroun 50-60 characters. This website's meta title is 63 characters long. |
Description | Site ekle kaliteli backlink kazan. Web Kuyusu, kaliteli içeriğin yer aldığı web dizinidir. Sitenizi web rehberimize ekleyerek aramıza katılın. Site ekle, hit kazan. | This meta description is 164 characters in length. Google suggests up to 320 characters at the very most to make sure the whole meta description is visible in search results page. |
Site speed | Around 0.8226 seconds | The website load speed is rather good. |
Alexa global rank | 2882431, as last checked | Based on Alexa Global, we can assume the website is not very popular. Mind you, Alexa's worth is questionable at best. |
Links on homepage | Around 57 links | This is a well-judged amount of links for a homepage. |
Backlinks amount | Approximately 54 | The number of backlinks seems awfully low. If possible, the webmaster should work towards building more through quality content and public awareness. |
HTML size | 17.6KB | A very good result, this. Remember, search engines such as Google place a lot of their website ratings on its speed. |
Website host server overview | Server status: online. Server IP address for this website is 88.255.89.173. | We apologize, but for some reason we were unable to gather enough data to provide a detailed insight at this time. |
If the basic information we presented you with above is not enough, get ready to dive in much deeper!
Now that the numbers are taken care of, we can go deeper and try to analyse the website from a user's perspective. More specifically, let's see if we can identify the target audience as well as a few related websites and categories.
Parameter | Current result | Assessment |
---|---|---|
Alternative websites | ankaraevdenevenakliyatfirmalari.com dizin.tc esamsun.com seodizin.com wmservisi.com |
These websites fall into the same categories as webkuyusu.com, more or less. By extension, they compete with the analysed website for the same target audience. |
Trying to acquire very accurate visitor data is immensely difficult and can only be done when given direct access to the server. However, there are ways to get approximate numbers.
The numbers themselves probably say enough, but we'll add some insight where possible.
Parameter | Current result | Assessment |
---|---|---|
Approximate time on site | 2:35 | Pretty good for an average time spent, wouldn't you say? |
ALEXA rating is based on the number of visitors a given page receives. The higher the visitor count, the higher the rating. Currently, ALEXA has over 4 million websites indexed. If you sense cynicism in our words, you're not mistaken - we think Alexa rating is overrated, to put it mildly. A website's worth (and contextual popularity) is more than the sum of the views. So take the rank with a grain of salt.
Servers are physical storage devices that contain all the files and databases associated with a specific website, sometimes more than one. At times, a server makes up several virtual devices - separate servers used for shared hosting (tends to be cheaper). Entering website address into the address bar of your browser starts the request process during which your browser contacts the server and asks for specific files and database entries in order to display the requested website.
What follows is certainly very geeky, but informative for the knowing. Dig in:
Header detail |
---|
HTTP/1.1 200 OK Date: Tue, 13 Jun 2017 01:07:50 GMT Server: X-Powered-By: PHP/5.4.45 Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma: no-cache Vary: Accept-Encoding,User-Agent Set-Cookie: PHPSESSID=1d646ea90d75ac72f6eaf94578d2ea86; path=/ Transfer-Encoding: chunked Content-Type: text/html |
WHOIS |
---|
Whois Server Version 2.0 Domain names in the .com and .net domains can now be registered with many different competing registrars. Go to http://www.internic.net for detailed information. Domain Name: WEBKUYUSU.COM Registrar: PDR LTD. D/B/A PUBLICDOMAINREGISTRY.COM Sponsoring Registrar IANA ID: 303 Whois Server: whois.PublicDomainRegistry.com Referral URL: http://www.publicdomainregistry.com Name Server: NS3.REHBERHOST.NET Name Server: NS4.REHBERHOST.NET Status: ok https://icann.org/epp#ok Updated Date: 14-jun-2016 Creation Date: 14-jun-2005 Expiration Date: 14-jun-2017 >>> Last update of whois database: Wed, 19 Apr 2017 21:44:37 GMT <<< For more information on Whois status codes, please visit https://icann.org/epp NOTICE: The expiration date displayed in this record is the date the registrar's sponsorship of the domain name registration in the registry is currently set to expire. This date does not necessarily reflect the expiration date of the domain name registrant's agreement with the sponsoring registrar. Users may consult the sponsoring registrar's Whois database to view the registrar's reported date of expiration for this registration. TERMS OF USE: You are not authorized to access or query our Whois database through the use of electronic processes that are high-volume and automated except as reasonably necessary to register domain names or modify existing registrations; the Data in VeriSign Global Registry Services' ("VeriSign") Whois database is provided by VeriSign for information purposes only, and to assist persons in obtaining information about or related to a domain name registration record. VeriSign does not guarantee its accuracy. By submitting a Whois query, you agree to abide by the following terms of use: You agree that you may use this Data only for lawful purposes and that under no circumstances will you use this Data to: (1) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via e-mail, telephone, or facsimile; or (2) enable high volume, automated, electronic processes that apply to VeriSign (or its computer systems). The compilation, repackaging, dissemination or other use of this Data is expressly prohibited without the prior written consent of VeriSign. You agree not to use electronic processes that are automated and high-volume to access or query the Whois database except as reasonably necessary to register domain names or modify existing registrations. VeriSign reserves the right to restrict your access to the Whois database in its sole discretion to ensure operational stability. VeriSign may restrict or terminate your access to the Whois database for failure to abide by these terms of use. VeriSign reserves the right to modify these terms at any time. The Registry database contains ONLY .COM, .NET, .EDU domains and Registrars. Domain Name: WEBKUYUSU.COM Registry Domain ID: 169808639_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.publicdomainregistry.com Registrar URL: www.publicdomainregistry.com Updated Date: 2016-06-14T11:15:21Z Creation Date: 2005-06-14T06:32:13Z Registrar Registration Expiration Date: 2017-06-14T06:32:13Z Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com Registrar IANA ID: 303 Domain Status: OK https://icann.org/epp#OK Registry Registrant ID: Not Available From Registry Registrant Name: RehberHOST.net Registrant Organization: RehberHOST.net Linux ve Windows Hosting Registrant Street: Ivedik Caddesi Karsiyaka Is Merkezi No: 486/214 Yenimahalle Yenimahalle 9270239231 Registrant City: Ankara Registrant State/Province: Ankara Registrant Postal Code: 06190 Registrant Country: TR Registrant Phone: +090.3123344496 Registrant Phone Ext: Registrant Fax: +090.3123344496 Registrant Fax Ext: Registrant Email: Registry Admin ID: Not Available From Registry Admin Name: RehberHOST.net Admin Organization: RehberHOST.net Linux ve Windows Hosting Admin Street: Ivedik Caddesi Karsiyaka Is Merkezi No: 486/214 Yenimahalle Yenimahalle 9270239231 Admin City: Ankara Admin State/Province: Ankara Admin Postal Code: 06190 Admin Country: TR Admin Phone: +090.3123344496 Admin Phone Ext: Admin Fax: +090.3123344496 Admin Fax Ext: Admin Email: Registry Tech ID: Not Available From Registry Tech Name: RehberHOST.net Tech Organization: RehberHOST.net Linux ve Windows Hosting Tech Street: Ivedik Caddesi Karsiyaka Is Merkezi No: 486/214 Yenimahalle Yenimahalle 9270239231 Tech City: Ankara Tech State/Province: Ankara Tech Postal Code: 06190 Tech Country: TR Tech Phone: +090.3123344496 Tech Phone Ext: Tech Fax: +090.3123344496 Tech Fax Ext: Tech Email: Name Server: ns3.rehberhost.net Name Server: ns4.rehberhost.net DNSSEC:Unsigned Registrar Abuse Contact Email: Registrar Abuse Contact Phone: +1.2013775952 URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2017-04-19T21:44:54Z <<< For more information on Whois status codes, please visit https://icann.org/epp Registration Service Provided By: REHBERHOST.NET The data in this whois database is provided to you for information purposes only, that is, to assist you in obtaining information about or related to a domain name registration record. We make this information available "as is", and do not guarantee its accuracy. By submitting a whois query, you agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to: (1) enable high volume, automated, electronic processes that stress or load this whois database system providing you this information; or (2) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via direct mail, electronic mail, or by telephone. The compilation, repackaging, dissemination or other use of this data is expressly prohibited without prior written consent from us. The Registrar of record is PDR Ltd. d/b/a PublicDomainRegistry.com. We reserve the right to modify these terms at any time. By submitting this query, you agree to abide by these terms. |
Now that you are hopefully done with webkuyusu.com, we invite you to read more of our in-depth reports. Try entering a new domain address in the search form at the top of this page, or on the homepage. Alternatively, refer to this list for more website overviews:
We have found so many alternative TLD extensions for webkuyusu.com. Here is the full list with 580 entries:
The following list of most frequent domain address mistypes associated with webkuyusu.com contains at least 1267 entries: