Look through the key statistics analysis before diving in deeper into our report:
Parameter | Current result | Assessment |
---|---|---|
Meta title | Albuquerque Defense Lawyer | The Romero Law Firm, P.A. | As meta title is a ranking factor, it's quite important to stick to search engine recommended length of aroun 50-60 characters. This website's meta title is 54 characters long. |
Description | Albuquerque Criminal Defense Attorney Román Romero aggressively defends clients in court. For effective representation, contact The Romero Law Firm, P.A. today! | This meta description is 160 characters in length. Google suggests up to 320 characters at the very most to make sure the whole meta description is visible in search results page. |
Site speed | Around 1.3093 seconds | The website load speed is rather good. |
Links on homepage | Around 90 links | This is a well-judged amount of links for a homepage. |
Backlinks amount | Approximately 3 | The number of backlinks seems awfully low. If possible, the webmaster should work towards building more through quality content and public awareness. |
HTML size | 42.5KB | A very good result, this. Remember, search engines such as Google place a lot of their website ratings on its speed. |
Website host server overview | Server status: online. Server IP address for this website is 216.87.172.157. | We apologize, but for some reason we were unable to gather enough data to provide a detailed insight at this time. |
If the basic information we presented you with above is not enough, get ready to dive in much deeper!
Now that the numbers are taken care of, we can go deeper and try to analyse the website from a user's perspective. More specifically, let's see if we can identify the target audience as well as a few related websites and categories.
Parameter | Current result | Assessment |
---|---|---|
Alternative websites | criminaldefenselawyernv.com criminaldefenselawyerlasvegas.com ghlawnv.com gtogata.com criminaldefenseoflasvegas.com |
These websites fall into the same categories as romerolawfirm.com, more or less. By extension, they compete with the analysed website for the same target audience. |
Servers are physical storage devices that contain all the files and databases associated with a specific website, sometimes more than one. At times, a server makes up several virtual devices - separate servers used for shared hosting (tends to be cheaper). Entering website address into the address bar of your browser starts the request process during which your browser contacts the server and asks for specific files and database entries in order to display the requested website.
What follows is certainly very geeky, but informative for the knowing. Dig in:
Header detail |
---|
HTTP/1.1 200 OK Cache-Control: public Content-Type: text/html; charset=utf-8 Expires: Sat, 01 Jan 2000 08:00:00 GMT Last-Modified: Tue, 26 Apr 2016 05:08:30 GMT ETag: 635972189105670000FalseFalseFalseFalseFalse Set-Cookie: ASP.NET_SessionId=k3cxb13nmmkjjuralx2ng42c; path=/; HttpOnly Set-Cookie: SEOT=1; expires=Thu, 14-Dec-2017 08:00:00 GMT; path=/ Date: Tue, 14 Nov 2017 09:07:11 GMT Content-Length: 43539 Set-Cookie: TS0101b2dd=01d40a94fa7952f984956686f2cc0763dcad8d78493f8883099adb21c578ec9c0e2562376ebaaee1ca20accbf5dad2a2e90bcabbd18df28b31c23e9dc80b8766877a079dafc8cb3ffa8ae877efe687a670c8aa8977; Path=/; Domain=.www.romerolawfirm.com |
Now that you are hopefully done with romerolawfirm.com, we invite you to read more of our in-depth reports. Try entering a new domain address in the search form at the top of this page, or on the homepage. Alternatively, refer to this list for more website overviews:
We have found so many alternative TLD extensions for romerolawfirm.com. Here is the full list with 580 entries:
The following list of most frequent domain address mistypes associated with romerolawfirm.com contains at least 1230 entries: