Look through the key statistics analysis before diving in deeper into our report:
Parameter | Current result | Assessment |
---|---|---|
Meta title | Clearwater Criminal Lawyer - Tampa - St. Petersburg Criminal Defense Attorney - Blake & Dorsten, P.A. | As meta title is a ranking factor, it's quite important to stick to search engine recommended length of aroun 50-60 characters. This website's meta title is 101 characters long. |
Description | Available 24/7 - Call (727) 286-6141 - Blake & Dorsten, P.A. is dedicated to serving our clients with a range of legal services including Criminal Defense and Crime cases. | This meta description is 171 characters in length. Google suggests up to 320 characters at the very most to make sure the whole meta description is visible in search results page. |
<meta> keywords | Available 24/7 - Call (727) 286-6141 - Blake & Dorsten, P.A. is dedicated to serving our clients with a range of legal services including Criminal Defense and Crime cases. | Strangely enough, meta keywords still seem to be used. We would not go down that road unless very carefully - meta keywords have not been known as a positive ranking factor for a while now. |
Site speed | Around 2.0775 seconds | Website ranking and usability can be greatly improved by reducing the time it takes to load it. |
Links on homepage | Around 89 links | This is a well-judged amount of links for a homepage. |
Backlinks amount | Approximately 17 | The number of backlinks seems awfully low. If possible, the webmaster should work towards building more through quality content and public awareness. |
HTML size | 28.6KB | Ah. Well. We were hoping for better results... We would urge the website owners to improve load speed as soon as possible. |
Website host server overview | Server status: online. Server IP address for this website is 64.41.139.14. | Hosting is provided by a respected company. Server located in the city of Mountain View, California, United States. |
Main domain information | Registered on: 2010-06-29 00:00:00 | We apologize, but for some reason we were unable to gather enough data to provide a detailed insight at this time. The website domain address is currently registered at GODADDY.COM, LLC |
If the basic information we presented you with above is not enough, get ready to dive in much deeper!
Now that the numbers are taken care of, we can go deeper and try to analyse the website from a user's perspective. More specifically, let's see if we can identify the target audience as well as a few related websites and categories.
Parameter | Current result | Assessment |
---|---|---|
Alternative websites | pallegarlawfirm.com helpgoodpeople.com defendtampa.com floridastandyourground.org tampaflcriminaldefenselawyers.com |
These websites fall into the same categories as blakedorstenlaw.com, more or less. By extension, they compete with the analysed website for the same target audience. |
ALEXA rating is based on the number of visitors a given page receives. The higher the visitor count, the higher the rating. Currently, ALEXA has over 4 million websites indexed. If you sense cynicism in our words, you're not mistaken - we think Alexa rating is overrated, to put it mildly. A website's worth (and contextual popularity) is more than the sum of the views. So take the rank with a grain of salt.
Servers are physical storage devices that contain all the files and databases associated with a specific website, sometimes more than one. At times, a server makes up several virtual devices - separate servers used for shared hosting (tends to be cheaper). Entering website address into the address bar of your browser starts the request process during which your browser contacts the server and asks for specific files and database entries in order to display the requested website.
What follows is certainly very geeky, but informative for the knowing. Dig in:
Header detail |
---|
HTTP/1.1 200 OK Date: Thu, 02 Nov 2017 20:22:48 GMT Server: Apache/2.2.15 (CentOS) Accept-Ranges: bytes Cache-Control: max-age=1, public Expires: Thu, 02 Nov 2017 20:22:49 GMT Vary: Accept-Encoding,User-Agent Pragma: public Connection: close Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 |
WHOIS |
---|
Whois Server Version 2.0 Domain names in the .com and .net domains can now be registered with many different competing registrars. Go to http://www.internic.net for detailed information. Domain Name: BLAKEDORSTENLAW.COM Registrar: GODADDY.COM, LLC Sponsoring Registrar IANA ID: 146 Whois Server: whois.godaddy.com Referral URL: http://www.godaddy.com Name Server: NS57.DOMAINCONTROL.COM Name Server: NS58.DOMAINCONTROL.COM Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited Updated Date: 07-dec-2015 Creation Date: 29-jun-2010 Expiration Date: 29-jun-2018 >>> Last update of whois database: Mon, 25 Jul 2016 12:25:47 GMT <<< For more information on Whois status codes, please visit https://icann.org/epp NOTICE: The expiration date displayed in this record is the date the registrar's sponsorship of the domain name registration in the registry is currently set to expire. This date does not necessarily reflect the expiration date of the domain name registrant's agreement with the sponsoring registrar. Users may consult the sponsoring registrar's Whois database to view the registrar's reported date of expiration for this registration. TERMS OF USE: You are not authorized to access or query our Whois database through the use of electronic processes that are high-volume and automated except as reasonably necessary to register domain names or modify existing registrations; the Data in VeriSign Global Registry Services' ("VeriSign") Whois database is provided by VeriSign for information purposes only, and to assist persons in obtaining information about or related to a domain name registration record. VeriSign does not guarantee its accuracy. By submitting a Whois query, you agree to abide by the following terms of use: You agree that you may use this Data only for lawful purposes and that under no circumstances will you use this Data to: (1) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via e-mail, telephone, or facsimile; or (2) enable high volume, automated, electronic processes that apply to VeriSign (or its computer systems). The compilation, repackaging, dissemination or other use of this Data is expressly prohibited without the prior written consent of VeriSign. You agree not to use electronic processes that are automated and high-volume to access or query the Whois database except as reasonably necessary to register domain names or modify existing registrations. VeriSign reserves the right to restrict your access to the Whois database in its sole discretion to ensure operational stability. VeriSign may restrict or terminate your access to the Whois database for failure to abide by these terms of use. VeriSign reserves the right to modify these terms at any time. The Registry database contains ONLY .COM, .NET, .EDU domains and Registrars. |
Now that you are hopefully done with blakedorstenlaw.com, we invite you to read more of our in-depth reports. Try entering a new domain address in the search form at the top of this page, or on the homepage. Alternatively, refer to this list for more website overviews:
We have found so many alternative TLD extensions for blakedorstenlaw.com. Here is the full list with 580 entries:
The following list of most frequent domain address mistypes associated with blakedorstenlaw.com contains at least 1204 entries: