Look through the key statistics analysis before diving in deeper into our report:
Parameter | Current result | Assessment |
---|---|---|
Description | Ankara firmaları tanıtım portalı. Ücretsiz reklam, bedava tanıtım, ilan, seriilan, duyuru, bedava reklam. | This meta description is 105 characters in length. Google suggests up to 320 characters at the very most to make sure the whole meta description is visible in search results page. |
Site speed | Around 0.5445 seconds | The website load speed is rather good. |
Alexa global rank | 930639, as last checked | Based on Alexa Global, we can assume the website is not very popular. Mind you, Alexa's worth is questionable at best. |
Backlinks amount | Approximately 11 | The number of backlinks seems awfully low. If possible, the webmaster should work towards building more through quality content and public awareness. |
HTML size | 0.3KB | A very good result, this. Remember, search engines such as Google place a lot of their website ratings on its speed. |
Website host server overview | Server status: online. Server IP address for this website is 209.99.40.223. | We apologize, but for some reason we were unable to gather enough data to provide a detailed insight at this time. |
If the basic information we presented you with above is not enough, get ready to dive in much deeper!
Now that the numbers are taken care of, we can go deeper and try to analyse the website from a user's perspective. More specifically, let's see if we can identify the target audience as well as a few related websites and categories.
Parameter | Current result | Assessment |
---|---|---|
Alternative websites | ankaraevdenevenakliyatfirmalari.com baskentfirmalari.com hazirscriptler.web.tr |
These websites fall into the same categories as baskentrehberi.net, more or less. By extension, they compete with the analysed website for the same target audience. |
ALEXA rating is based on the number of visitors a given page receives. The higher the visitor count, the higher the rating. Currently, ALEXA has over 4 million websites indexed. If you sense cynicism in our words, you're not mistaken - we think Alexa rating is overrated, to put it mildly. A website's worth (and contextual popularity) is more than the sum of the views. So take the rank with a grain of salt.
Servers are physical storage devices that contain all the files and databases associated with a specific website, sometimes more than one. At times, a server makes up several virtual devices - separate servers used for shared hosting (tends to be cheaper). Entering website address into the address bar of your browser starts the request process during which your browser contacts the server and asks for specific files and database entries in order to display the requested website.
What follows is certainly very geeky, but informative for the knowing. Dig in:
Header detail |
---|
HTTP/1.1 200 OK Date: Sat, 03 Jun 2017 12:57:26 GMT Server: Apache/2.4.25 (Debian) Set-Cookie: vsid=930vr2440402467102654; expires=Thu, 02-Jun-2022 12:57:26 GMT; Max-Age=157680000; path=/; domain=baskentrehberi.net; HttpOnly Content-Length: 272 Content-Type: text/html; charset=UTF-8 |
WHOIS |
---|
Whois Server Version 2.0 Domain names in the .com and .net domains can now be registered with many different competing registrars. Go to http://www.internic.net for detailed information. Domain Name: BASKENTREHBERI.NET Registrar: PDR LTD. D/B/A PUBLICDOMAINREGISTRY.COM Sponsoring Registrar IANA ID: 303 Whois Server: whois.PublicDomainRegistry.com Referral URL: http://www.publicdomainregistry.com Name Server: NS3.REHBERHOST.NET Name Server: NS4.REHBERHOST.NET Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Updated Date: 26-may-2016 Creation Date: 24-may-2010 Expiration Date: 24-may-2017 >>> Last update of whois database: Tue, 23 May 2017 23:38:08 GMT <<< For more information on Whois status codes, please visit https://icann.org/epp NOTICE: The expiration date displayed in this record is the date the registrar's sponsorship of the domain name registration in the registry is currently set to expire. This date does not necessarily reflect the expiration date of the domain name registrant's agreement with the sponsoring registrar. Users may consult the sponsoring registrar's Whois database to view the registrar's reported date of expiration for this registration. TERMS OF USE: You are not authorized to access or query our Whois database through the use of electronic processes that are high-volume and automated except as reasonably necessary to register domain names or modify existing registrations; the Data in VeriSign Global Registry Services' ("VeriSign") Whois database is provided by VeriSign for information purposes only, and to assist persons in obtaining information about or related to a domain name registration record. VeriSign does not guarantee its accuracy. By submitting a Whois query, you agree to abide by the following terms of use: You agree that you may use this Data only for lawful purposes and that under no circumstances will you use this Data to: (1) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via e-mail, telephone, or facsimile; or (2) enable high volume, automated, electronic processes that apply to VeriSign (or its computer systems). The compilation, repackaging, dissemination or other use of this Data is expressly prohibited without the prior written consent of VeriSign. You agree not to use electronic processes that are automated and high-volume to access or query the Whois database except as reasonably necessary to register domain names or modify existing registrations. VeriSign reserves the right to restrict your access to the Whois database in its sole discretion to ensure operational stability. VeriSign may restrict or terminate your access to the Whois database for failure to abide by these terms of use. VeriSign reserves the right to modify these terms at any time. The Registry database contains ONLY .COM, .NET, .EDU domains and Registrars. |
Now that you are hopefully done with baskentrehberi.net, we invite you to read more of our in-depth reports. Try entering a new domain address in the search form at the top of this page, or on the homepage. Alternatively, refer to this list for more website overviews:
We have found so many alternative TLD extensions for baskentrehberi.net. Here is the full list with 580 entries:
The following list of most frequent domain address mistypes associated with baskentrehberi.net contains at least 1365 entries: