Look through the key statistics analysis before diving in deeper into our report:
Parameter | Current result | Assessment |
---|---|---|
Meta title | .:: SRI SUBRAHMANYASWAMY DEVALAYAM SKANDAGIRI ::. | As meta title is a ranking factor, it's quite important to stick to search engine recommended length of aroun 50-60 characters. This website's meta title is 49 characters long. |
Site speed | Around 1.8998 seconds | Website ranking and usability can be greatly improved by reducing the time it takes to load it. |
Alexa global rank | 951997, as last checked | Based on Alexa Global, we can assume the website is not very popular. Mind you, Alexa's worth is questionable at best. |
Links on homepage | Around 19 links | This is a well-judged amount of links for a homepage. |
HTML size | 48.7KB | Ah. Well. We were hoping for better results... We would urge the website owners to improve load speed as soon as possible. |
Website host server overview | Server status: online. Server IP address for this website is 103.24.202.75. | We apologize, but for some reason we were unable to gather enough data to provide a detailed insight at this time. |
If the basic information we presented you with above is not enough, get ready to dive in much deeper!
ALEXA rating is based on the number of visitors a given page receives. The higher the visitor count, the higher the rating. Currently, ALEXA has over 4 million websites indexed. If you sense cynicism in our words, you're not mistaken - we think Alexa rating is overrated, to put it mildly. A website's worth (and contextual popularity) is more than the sum of the views. So take the rank with a grain of salt.
Servers are physical storage devices that contain all the files and databases associated with a specific website, sometimes more than one. At times, a server makes up several virtual devices - separate servers used for shared hosting (tends to be cheaper). Entering website address into the address bar of your browser starts the request process during which your browser contacts the server and asks for specific files and database entries in order to display the requested website.
What follows is certainly very geeky, but informative for the knowing. Dig in:
Header detail |
---|
HTTP/1.1 200 OK Date: Thu, 29 Jun 2017 06:14:19 GMT Server: Apache X-Powered-By: PHP/5.6.27 Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma: no-cache Set-Cookie: PHPSESSID=dcec1d6f0e5c808b3d2fd4fe65e006b3; path=/ Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 |
WHOIS |
---|
Domain Name: SRISUBRAHMANYASWAMYDEVALAYAMSKANDAGIRI.ORG Registry Domain ID: D162151921-LROR Registrar WHOIS Server: Registrar URL: http://www.PublicDomainRegistry.com Updated Date: 2017-04-12T04:37:57Z Creation Date: 2011-04-29T14:24:28Z Registry Expiry Date: 2018-04-29T14:24:28Z Registrar Registration Expiration Date: Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com Registrar IANA ID: 303 Registrar Abuse Contact Email: Registrar Abuse Contact Phone: +1.2013775952 Reseller: Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Registry Registrant ID: C137364795-LROR Registrant Name: Outline Designs Registrant Organization: Outline Designs Registrant Street: Flat No: 608, taj enclave Registrant Street: Lakdikapool Registrant City: Hyderabad Registrant State/Province: Andhra Pradesh Registrant Postal Code: 500004 Registrant Country: IN Registrant Phone: +91.04064538777 Registrant Phone Ext: Registrant Fax: Registrant Fax Ext: Registrant Email: Registry Admin ID: C137364795-LROR Admin Name: Outline Designs Admin Organization: Outline Designs Admin Street: Flat No: 608, taj enclave Admin Street: Lakdikapool Admin City: Hyderabad Admin State/Province: Andhra Pradesh Admin Postal Code: 500004 Admin Country: IN Admin Phone: +91.04064538777 Admin Phone Ext: Admin Fax: Admin Fax Ext: Admin Email: Registry Tech ID: C137364795-LROR Tech Name: Outline Designs Tech Organization: Outline Designs Tech Street: Flat No: 608, taj enclave Tech Street: Lakdikapool Tech City: Hyderabad Tech State/Province: Andhra Pradesh Tech Postal Code: 500004 Tech Country: IN Tech Phone: +91.04064538777 Tech Phone Ext: Tech Fax: Tech Fax Ext: Tech Email: Name Server: NS1.OUTLINE.CO.IN Name Server: NS2.OUTLINE.CO.IN DNSSEC: unsigned URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2017-05-14T21:03:03Z <<< For more information on Whois status codes, please visit https://icann.org/epp Access to Public Interest Registry WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the Public Interest Registry registry database. The data in this record is provided by Public Interest Registry for informational purposes only, and Public Interest Registry does not guarantee its accuracy. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to: (a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator, a Registrar, or Afilias except as reasonably necessary to register domain names or modify existing registrations. All rights reserved. Public Interest Registry reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy. |
Now that you are hopefully done with srisubrahmanyaswamydevalayamskandagiri.org, we invite you to read more of our in-depth reports. Try entering a new domain address in the search form at the top of this page, or on the homepage. Alternatively, refer to this list for more website overviews:
We have found so many alternative TLD extensions for srisubrahmanyaswamydevalayamskandagiri.org. Here is the full list with 580 entries:
The following list of most frequent domain address mistypes associated with srisubrahmanyaswamydevalayamskandagiri.org contains at least 1544 entries: