Look through the key statistics analysis before diving in deeper into our report:
Parameter | Current result | Assessment |
---|---|---|
Meta title | PICKAWAY COUNTY COMMUNITY ACTION ORGANIZATION - Home Page | As meta title is a ranking factor, it's quite important to stick to search engine recommended length of aroun 50-60 characters. This website's meta title is 57 characters long. |
Description | A description has not been provided for this site. | This meta description is 50 characters in length. Google suggests up to 320 characters at the very most to make sure the whole meta description is visible in search results page. |
Site speed | Around 1.0088 seconds | The website load speed is rather good. |
Alexa global rank | 18781761, as last checked | Based on Alexa Global, we can assume the website is not very popular. Mind you, Alexa's worth is questionable at best. |
Quantcast | Current rank, according to our database, is at 126416 | Quantcast does not rank this website very high, which should in theory mean it's not that popular. Having said that, popularity is context-dependant, so take this with a grain of salt. |
Links on homepage | Around 13 links | This is a well-judged amount of links for a homepage. |
Backlinks amount | Approximately 14 | The number of backlinks seems awfully low. If possible, the webmaster should work towards building more through quality content and public awareness. |
HTML size | 29.2KB | A very good result, this. Remember, search engines such as Google place a lot of their website ratings on its speed. |
Website host server overview | Server status: online. Server IP address for this website is 199.34.228.77. | We apologize, but for some reason we were unable to gather enough data to provide a detailed insight at this time. |
If the basic information we presented you with above is not enough, get ready to dive in much deeper!
Now that the numbers are taken care of, we can go deeper and try to analyse the website from a user's perspective. More specifically, let's see if we can identify the target audience as well as a few related websites and categories.
Parameter | Current result | Assessment |
---|---|---|
Alternative websites | pickawayjfs.org pickaway.com circlevilledba.com pickawayfamilyandchildrenfirst.org pickaway.org |
These websites fall into the same categories as picca.info, more or less. By extension, they compete with the analysed website for the same target audience. |
ALEXA rating is based on the number of visitors a given page receives. The higher the visitor count, the higher the rating. Currently, ALEXA has over 4 million websites indexed. If you sense cynicism in our words, you're not mistaken - we think Alexa rating is overrated, to put it mildly. A website's worth (and contextual popularity) is more than the sum of the views. So take the rank with a grain of salt.
QUANTCAST is a data processing company that mostly gathers information for advertising companies. It specializes in real-time audience analysis and, as you may have gathered, is really quite similar to Alexa, if perhaps not as infamous. To our knowledge, the company has rated and ranked approximately 6701650 websites so far. There is always a caveat with these sort of ranking systems - they don't really take any context into account. As such, their usefulness is debatable at best. Don't overthink this rank - it's just a number, really.
Servers are physical storage devices that contain all the files and databases associated with a specific website, sometimes more than one. At times, a server makes up several virtual devices - separate servers used for shared hosting (tends to be cheaper). Entering website address into the address bar of your browser starts the request process during which your browser contacts the server and asks for specific files and database entries in order to display the requested website.
What follows is certainly very geeky, but informative for the knowing. Dig in:
Header detail |
---|
HTTP/1.1 200 OK Date: Sun, 22 Oct 2017 13:59:22 GMT Server: Apache Set-Cookie: is_mobile=0; path=/; domain=www.picca.info Set-Cookie: language=en; expires=Sun, 05-Nov-2017 13:59:22 GMT; Max-Age=1209600; path=/ Cache-Control: private ETag: W/"445a43ae611e2dac349edc76f15552e1" Vary: Accept-Encoding,User-Agent X-Host: pages36.sf2p.intern.weebly.net X-UA-Compatible: IE=edge,chrome=1 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 |
WHOIS |
---|
Domain Name: PICCA.INFO Registry Domain ID: D2694252-LRMS Registrar WHOIS Server: Registrar URL: www.enom.com Updated Date: 2017-03-11T15:33:30Z Creation Date: 2003-06-02T21:49:13Z Registry Expiry Date: 2017-06-02T21:49:13Z Registrar Registration Expiration Date: Registrar: eNom, Inc. Registrar IANA ID: 48 Registrar Abuse Contact Email: Registrar Abuse Contact Phone: Reseller: Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Registry Registrant ID: C143647131-LRMS Registrant Name: Linda Stanton Registrant Organization: PICCA Registrant Street: 469 East Ohio St. Registrant City: Circleville Registrant State/Province: OH Registrant Postal Code: 43113 Registrant Country: US Registrant Phone: +1.7404771655 Registrant Phone Ext: Registrant Fax: Registrant Fax Ext: Registrant Email: Registry Admin ID: C143647134-LRMS Admin Name: Dale Kuhlwein Admin Organization: PICCA Admin Street: 469 East Ohio St. Admin City: Circleville Admin State/Province: OH Admin Postal Code: 43113 Admin Country: US Admin Phone: +1.7404771655 Admin Phone Ext: Admin Fax: Admin Fax Ext: Admin Email: Registry Tech ID: C143647133-LRMS Tech Name: Jeremy Henry Tech Organization: ADS IT Solutions Tech Street: 33 N. Plaza Blvd Tech City: Chillicothe Tech State/Province: OH Tech Postal Code: 45601 Tech Country: US Tech Phone: +1.7407753754 Tech Phone Ext: Tech Fax: Tech Fax Ext: Tech Email: j. Registry Billing ID: C143647131-LRMS Billing Name: Linda Stanton Billing Organization: PICCA Billing Street: 469 East Ohio St. Billing City: Circleville Billing State/Province: OH Billing Postal Code: 43113 Billing Country: US Billing Phone: +1.7404771655 Billing Phone Ext: Billing Fax: Billing Fax Ext: Billing Email: Name Server: DNS1.NAME-SERVICES.COM Name Server: DNS2.NAME-SERVICES.COM Name Server: DNS3.NAME-SERVICES.COM Name Server: DNS4.NAME-SERVICES.COM Name Server: DNS5.NAME-SERVICES.COM DNSSEC: unsigned URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2017-04-28T23:47:53Z <<< For more information on Whois status codes, please visit https://icann.org/epp Access to AFILIAS WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the Afilias registry database. The data in this record is provided by Afilias Limited for informational purposes only, and Afilias does not guarantee its accuracy. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to(a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator, a Registrar, or Afilias except as reasonably necessary to register domain names or modify existing registrations. All rights reserved. Afilias reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy. |
Now that you are hopefully done with picca.info, we invite you to read more of our in-depth reports. Try entering a new domain address in the search form at the top of this page, or on the homepage. Alternatively, refer to this list for more website overviews:
We have found so many alternative TLD extensions for picca.info. Here is the full list with 580 entries:
The following list of most frequent domain address mistypes associated with picca.info contains at least 1190 entries: