Look through the key statistics analysis before diving in deeper into our report:
Parameter | Current result | Assessment |
---|---|---|
Meta title | n4 food & health | As meta title is a ranking factor, it's quite important to stick to search engine recommended length of aroun 50-60 characters. This website's meta title is 16 characters long. |
Description | <head> <title>Nutritionist and Dietitian - n4foodandhealth.com</title> <meta name="description" content=" Find a dietitian Melbourne, dietitian Brisbane, nutritionist Sydney, nutritionist Perth and also in Adelaide and Parramatta." /> <meta name="keywords" content="nutritionist Sydney, nutritionist Melbourne, Dietitian" /> <meta name="author" content="n4 food and health" <meta name="robots" content="index, follow" /> </head> | This meta description is 434 characters in length. Google suggests up to 320 characters at the very most to make sure the whole meta description is visible in search results page. |
<meta> keywords | <head> <title>Nutritionist and Dietitian - n4foodandhealth.com</title> <meta name="description" content=" Contact a dietitian Melbourne, dietitian Brisbane, nutritionist Sydney, nutritionist Perth and also in Adelaide and Parramatta." /> <meta name="keywords" content="nutritionist Sydney, nutritionist Melbourne, Dietitian" /> <meta name="author" content="n4 food and health" <meta name="robots" content="index, follow" /> </head> Nutrition information Nutrition advice Healthy eating Healthy food Good nutrition Eating well Weight loss Diet Dietitian/dietician Nutritionist | Strangely enough, meta keywords still seem to be used. We would not go down that road unless very carefully - meta keywords have not been known as a positive ranking factor for a while now. |
Site speed | Around 2.1123 seconds | Website ranking and usability can be greatly improved by reducing the time it takes to load it. |
Alexa global rank | 13792367, as last checked | Based on Alexa Global, we can assume the website is not very popular. Mind you, Alexa's worth is questionable at best. |
Links on homepage | Around 81 links | This is a well-judged amount of links for a homepage. |
Backlinks amount | Approximately 35 | The number of backlinks seems awfully low. If possible, the webmaster should work towards building more through quality content and public awareness. |
HTML size | 24.5KB | Ah. Well. We were hoping for better results... We would urge the website owners to improve load speed as soon as possible. |
Website host server overview | Server status: online. Server IP address for this website is 175.41.141.177. | We apologize, but for some reason we were unable to gather enough data to provide a detailed insight at this time. |
If the basic information we presented you with above is not enough, get ready to dive in much deeper!
Now that the numbers are taken care of, we can go deeper and try to analyse the website from a user's perspective. More specifically, let's see if we can identify the target audience as well as a few related websites and categories.
Parameter | Current result | Assessment |
---|---|---|
Alternative websites | bennefit.com.au optimisenutrition.com.au recoveryresources.com.au wishartvillagefamilypractice.com.au nosterprobiotics.com |
These websites fall into the same categories as n4foodandhealth.com, more or less. By extension, they compete with the analysed website for the same target audience. |
ALEXA rating is based on the number of visitors a given page receives. The higher the visitor count, the higher the rating. Currently, ALEXA has over 4 million websites indexed. If you sense cynicism in our words, you're not mistaken - we think Alexa rating is overrated, to put it mildly. A website's worth (and contextual popularity) is more than the sum of the views. So take the rank with a grain of salt.
Servers are physical storage devices that contain all the files and databases associated with a specific website, sometimes more than one. At times, a server makes up several virtual devices - separate servers used for shared hosting (tends to be cheaper). Entering website address into the address bar of your browser starts the request process during which your browser contacts the server and asks for specific files and database entries in order to display the requested website.
What follows is certainly very geeky, but informative for the knowing. Dig in:
Header detail |
---|
HTTP/1.1 200 OK Date: Fri, 27 Oct 2017 05:41:20 GMT Server: Apache/2.2.3 (CentOS) X-Powered-By: PHP/5.3.3 Set-Cookie: PHPSESSID=lhjrian8hbhgjec1eqmajh5og5; path=/ Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma: no-cache Connection: close Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 |
Now that you are hopefully done with n4foodandhealth.com, we invite you to read more of our in-depth reports. Try entering a new domain address in the search form at the top of this page, or on the homepage. Alternatively, refer to this list for more website overviews:
We have found so many alternative TLD extensions for n4foodandhealth.com. Here is the full list with 580 entries:
The following list of most frequent domain address mistypes associated with n4foodandhealth.com contains at least 1260 entries: