Look through the key statistics analysis before diving in deeper into our report:
Parameter | Current result | Assessment |
---|---|---|
Meta title | Modern Family Hollywood Here I Come Sweepstakes | As meta title is a ranking factor, it's quite important to stick to search engine recommended length of aroun 50-60 characters. This website's meta title is 47 characters long. |
Description | Enter for a chance to win a trip to Hollywood, California, and attend a Modern Family table read! | This meta description is 97 characters in length. Google suggests up to 320 characters at the very most to make sure the whole meta description is visible in search results page. |
Site speed | Around 2.1673 seconds | Website ranking and usability can be greatly improved by reducing the time it takes to load it. |
Alexa global rank | 951415, as last checked | Based on Alexa Global, we can assume the website is not very popular. Mind you, Alexa's worth is questionable at best. |
Quantcast | Current rank, according to our database, is at 951340 | Quantcast does not rank this website very high, which should in theory mean it's not that popular. Having said that, popularity is context-dependant, so take this with a grain of salt. |
Links on homepage | Around 7 links | This looks... a little suspicious, to be honest. |
HTML size | 3.2KB | Ah. Well. We were hoping for better results... We would urge the website owners to improve load speed as soon as possible. |
Website host server overview | Server status: online. Server IP address for this website is 159.135.22.126. | We apologize, but for some reason we were unable to gather enough data to provide a detailed insight at this time. |
If the basic information we presented you with above is not enough, get ready to dive in much deeper!
ALEXA rating is based on the number of visitors a given page receives. The higher the visitor count, the higher the rating. Currently, ALEXA has over 4 million websites indexed. If you sense cynicism in our words, you're not mistaken - we think Alexa rating is overrated, to put it mildly. A website's worth (and contextual popularity) is more than the sum of the views. So take the rank with a grain of salt.
QUANTCAST is a data processing company that mostly gathers information for advertising companies. It specializes in real-time audience analysis and, as you may have gathered, is really quite similar to Alexa, if perhaps not as infamous. To our knowledge, the company has rated and ranked approximately 163025196 websites so far. There is always a caveat with these sort of ranking systems - they don't really take any context into account. As such, their usefulness is debatable at best. Don't overthink this rank - it's just a number, really.
Servers are physical storage devices that contain all the files and databases associated with a specific website, sometimes more than one. At times, a server makes up several virtual devices - separate servers used for shared hosting (tends to be cheaper). Entering website address into the address bar of your browser starts the request process during which your browser contacts the server and asks for specific files and database entries in order to display the requested website.
What follows is certainly very geeky, but informative for the knowing. Dig in:
Header detail |
---|
HTTP/1.1 200 OK Server: Microsoft-IIS/8.5 X-AspNet-Version: 4.0.30319 Cache-Control: private Content-Type: text/html; charset=utf-8 Date: Mon, 12 Jun 2017 19:12:52 GMT Set-Cookie: X-Mapping-lgdkfegg=6BE9AB5F9E84B24C569BBD3444A877F8; path=/ X-Powered-By: ASP.NET Content-Length: 3231 |
WHOIS |
---|
Whois Server Version 2.0 Domain names in the .com and .net domains can now be registered with many different competing registrars. Go to http://www.internic.net for detailed information. Domain Name: MODERNFAMILYNIGHTLYSWEEPSTAKES.COM Registrar: MARKMONITOR INC. Sponsoring Registrar IANA ID: 292 Whois Server: whois.markmonitor.com Referral URL: http://www.markmonitor.com Name Server: DNS1.STABLETRANSIT.COM Name Server: DNS2.STABLETRANSIT.COM Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited Updated Date: 08-jul-2016 Creation Date: 08-aug-2014 Expiration Date: 08-aug-2017 >>> Last update of whois database: Fri, 14 Apr 2017 04:38:37 GMT <<< For more information on Whois status codes, please visit https://icann.org/epp NOTICE: The expiration date displayed in this record is the date the registrar's sponsorship of the domain name registration in the registry is currently set to expire. This date does not necessarily reflect the expiration date of the domain name registrant's agreement with the sponsoring registrar. Users may consult the sponsoring registrar's Whois database to view the registrar's reported date of expiration for this registration. TERMS OF USE: You are not authorized to access or query our Whois database through the use of electronic processes that are high-volume and automated except as reasonably necessary to register domain names or modify existing registrations; the Data in VeriSign Global Registry Services' ("VeriSign") Whois database is provided by VeriSign for information purposes only, and to assist persons in obtaining information about or related to a domain name registration record. VeriSign does not guarantee its accuracy. By submitting a Whois query, you agree to abide by the following terms of use: You agree that you may use this Data only for lawful purposes and that under no circumstances will you use this Data to: (1) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via e-mail, telephone, or facsimile; or (2) enable high volume, automated, electronic processes that apply to VeriSign (or its computer systems). The compilation, repackaging, dissemination or other use of this Data is expressly prohibited without the prior written consent of VeriSign. You agree not to use electronic processes that are automated and high-volume to access or query the Whois database except as reasonably necessary to register domain names or modify existing registrations. VeriSign reserves the right to restrict your access to the Whois database in its sole discretion to ensure operational stability. VeriSign may restrict or terminate your access to the Whois database for failure to abide by these terms of use. VeriSign reserves the right to modify these terms at any time. The Registry database contains ONLY .COM, .NET, .EDU domains and Registrars. Domain Name: modernfamilynightlysweepstakes.com Registry Domain ID: 1870313490_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.markmonitor.com Registrar URL: http://www.markmonitor.com Updated Date: 2016-07-08T02:07:57-0700 Creation Date: 2014-08-08T15:21:59-0700 Registrar Registration Expiration Date: 2017-08-08T00:00:00-0700 Registrar: MarkMonitor, Inc. Registrar IANA ID: 292 Registrar Abuse Contact Email: Registrar Abuse Contact Phone: +1.2083895740 Domain Status: clientUpdateProhibited (https://www.icann.org/epp#clientUpdateProhibited) Domain Status: clientTransferProhibited (https://www.icann.org/epp#clientTransferProhibited) Domain Status: clientDeleteProhibited (https://www.icann.org/epp#clientDeleteProhibited) Registry Registrant ID: Registrant Name: Intellectual Property Department Registrant Organization: Twentieth Century Fox Film Corporation Registrant Street: P.O. Box 900, Registrant City: Beverly Hills Registrant State/Province: CA Registrant Postal Code: 90213-0900 Registrant Country: US Registrant Phone: +1.3103691000 Registrant Phone Ext: Registrant Fax: Registrant Fax Ext: Registrant Email: Registry Admin ID: Admin Name: Intellectual Property Department Admin Organization: Twentieth Century Fox Film Corporation Admin Street: P.O. Box 900, Admin City: Beverly Hills Admin State/Province: CA Admin Postal Code: 90213-0900 Admin Country: US Admin Phone: +1.3103691000 Admin Phone Ext: Admin Fax: Admin Fax Ext: Admin Email: Registry Tech ID: Tech Name: Intellectual Property Department Tech Organization: Twentieth Century Fox Film Corporation Tech Street: P.O. Box 900, Tech City: Beverly Hills Tech State/Province: CA Tech Postal Code: 90213-0900 Tech Country: US Tech Phone: +1.3103691000 Tech Phone Ext: Tech Fax: Tech Fax Ext: Tech Email: Name Server: dns2.stabletransit.com Name Server: dns1.stabletransit.com DNSSEC: unsigned URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2017-04-13T21:38:57-0700 <<< The Data in MarkMonitor.com's WHOIS database is provided by MarkMonitor.com for information purposes, and to assist persons in obtaining information about or related to a domain name registration record. MarkMonitor.com does not guarantee its accuracy. By submitting a WHOIS query, you agree that you will use this Data only for lawful purposes and that, under no circumstances will you use this Data to: (1) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via e-mail (spam); or (2) enable high volume, automated, electronic processes that apply to MarkMonitor.com (or its systems). MarkMonitor.com reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy. MarkMonitor is the Global Leader in Online Brand Protection. MarkMonitor Domain Management(TM) MarkMonitor Brand Protection(TM) MarkMonitor AntiPiracy(TM) MarkMonitor AntiFraud(TM) Professional and Managed Services Visit MarkMonitor at http://www.markmonitor.com Contact us at +1.8007459229 In Europe, at +44.02032062220 For more information on Whois status codes, please visit https://www.icann.org/resources/pages/epp-status-codes-2014-06-16-en |
Now that you are hopefully done with modernfamilynightlysweepstakes.com, we invite you to read more of our in-depth reports. Try entering a new domain address in the search form at the top of this page, or on the homepage. Alternatively, refer to this list for more website overviews:
We have found so many alternative TLD extensions for modernfamilynightlysweepstakes.com. Here is the full list with 580 entries:
The following list of most frequent domain address mistypes associated with modernfamilynightlysweepstakes.com contains at least 1194 entries: