Look through the key statistics analysis before diving in deeper into our report:
Parameter | Current result | Assessment |
---|---|---|
Meta title | Default Parallels Plesk Panel Page | As meta title is a ranking factor, it's quite important to stick to search engine recommended length of aroun 50-60 characters. This website's meta title is 34 characters long. |
Description | A description has not been provided for this site. | This meta description is 50 characters in length. Google suggests up to 320 characters at the very most to make sure the whole meta description is visible in search results page. |
Site speed | Around 0.0521 seconds | The website load speed is rather good. |
Alexa global rank | 757572, as last checked | Based on Alexa Global, we can assume the website is not very popular. Mind you, Alexa's worth is questionable at best. |
Links on homepage | Around 20 links | This is a well-judged amount of links for a homepage. |
Backlinks amount | Approximately 514 | A good amount of backlinks. |
HTML size | 9.1KB | A very good result, this. Remember, search engines such as Google place a lot of their website ratings on its speed. |
Website host server overview | Server status: online. Server IP address for this website is 176.31.226.210. | We apologize, but for some reason we were unable to gather enough data to provide a detailed insight at this time. |
If the basic information we presented you with above is not enough, get ready to dive in much deeper!
Now that the numbers are taken care of, we can go deeper and try to analyse the website from a user's perspective. More specifically, let's see if we can identify the target audience as well as a few related websites and categories.
Parameter | Current result | Assessment |
---|---|---|
Alternative websites | entrelane.com booyahcraft.com codingpiratesgame.com bufsoftware.com downloadgracevanderwaalperfectlyimperfect.wordpress.com |
These websites fall into the same categories as mafia2.fr, more or less. By extension, they compete with the analysed website for the same target audience. |
ALEXA rating is based on the number of visitors a given page receives. The higher the visitor count, the higher the rating. Currently, ALEXA has over 4 million websites indexed. If you sense cynicism in our words, you're not mistaken - we think Alexa rating is overrated, to put it mildly. A website's worth (and contextual popularity) is more than the sum of the views. So take the rank with a grain of salt.
Servers are physical storage devices that contain all the files and databases associated with a specific website, sometimes more than one. At times, a server makes up several virtual devices - separate servers used for shared hosting (tends to be cheaper). Entering website address into the address bar of your browser starts the request process during which your browser contacts the server and asks for specific files and database entries in order to display the requested website.
What follows is certainly very geeky, but informative for the knowing. Dig in:
Header detail |
---|
HTTP/1.1 200 OK Date: Mon, 05 Jun 2017 04:31:35 GMT Server: Apache Last-Modified: Sun, 11 Aug 2013 15:18:52 GMT ETag: "5040c8b-2488-4e3ad8687df33" Accept-Ranges: bytes Content-Length: 9352 Vary: Accept-Encoding X-Powered-By: PleskLin Content-Type: text/html |
WHOIS |
---|
domain: mafia2.fr status: ACTIVE hold: NO holder-c: ANO00-FRNIC admin-c: ANO00-FRNIC tech-c: HU3-FRNIC zone-c: NFC1-FRNIC nsl-id: NSL46087-FRNIC registrar: 1&1 Internet SE Expiry Date: 22/08/2017 created: 22/08/2007 last-update: 22/08/2016 source: FRNIC ns-list: NSL46087-FRNIC nserver: 91-121-51-224.ovh.net nserver: 46-105-51-163.ovh.net source: FRNIC registrar: 1&1 Internet SE type: Isp Option 1 address: Ernst-Frey Strasse 9 address: 76135 KARLSRUHE country: DE phone: +49 721 91374 50 fax-no: +49 721 91374 215 e-mail: website: http://registrar.1and1.info anonymous: NO registered: 17/01/2001 source: FRNIC nic-hdl: ANO00-FRNIC type: PERSON contact: Ano Nymous remarks: -------------- WARNING -------------- remarks: While the registrar knows him/her, remarks: this person chose to restrict access remarks: to his/her personal data. So PLEASE, remarks: don't send emails to Ano Nymous. This remarks: address is bogus and there is no hope remarks: of a reply. remarks: -------------- WARNING -------------- registrar: 1&1 Internet SE changed: 09/08/2006 anonymous@anonymous anonymous: YES obsoleted: NO eligstatus: ok eligdate: 09/08/2006 00:00:00 source: FRNIC nic-hdl: HU3-FRNIC type: ROLE contact: Hostmaster UNETUN address: 1&1 Internet Sarl. address: 7, place de la Gare address: 57200 Sarreguemines country: FR e-mail: admin-c: IR2-FRNIC tech-c: IR2-FRNIC registrar: 1&1 Internet SE changed: 15/03/2004 anonymous: NO obsoleted: NO source: FRNIC |
Now that you are hopefully done with mafia2.fr, we invite you to read more of our in-depth reports. Try entering a new domain address in the search form at the top of this page, or on the homepage. Alternatively, refer to this list for more website overviews:
We have found so many alternative TLD extensions for mafia2.fr. Here is the full list with 580 entries:
The following list of most frequent domain address mistypes associated with mafia2.fr contains at least 1140 entries: