Look through the key statistics analysis before diving in deeper into our report:
Parameter | Current result | Assessment |
---|---|---|
Meta title | Village of Gays Mills - Village of Gays Mills | As meta title is a ranking factor, it's quite important to stick to search engine recommended length of aroun 50-60 characters. This website's meta title is 45 characters long. |
Description | The Village of Gays Mills lies in a valley among the steeply chiseled bluffs of the Ocooch Mountains located in the heart of the region known as the Driftless Area of Southwest Wisconsin. The area’s unique topography is the result of escaping the land-fla | This meta description is 255 characters in length. Google suggests up to 320 characters at the very most to make sure the whole meta description is visible in search results page. |
<meta> keywords | Gays Mills, Wisconsin, Driftless Wisconsin, Driftless Area, Driftless, Ocooch Mountains, Apple Fest, Apple Festival, Folk Festival, Folk Fest, Floods, Hills, Mountains, WI, Wisc., | Strangely enough, meta keywords still seem to be used. We would not go down that road unless very carefully - meta keywords have not been known as a positive ranking factor for a while now. |
Site speed | Around 1.5341 seconds | Website ranking and usability can be greatly improved by reducing the time it takes to load it. |
Alexa global rank | 3209375, as last checked | Based on Alexa Global, we can assume the website is not very popular. Mind you, Alexa's worth is questionable at best. |
Links on homepage | Around 7 links | This looks... a little suspicious, to be honest. |
Backlinks amount | Approximately 39 | The number of backlinks seems awfully low. If possible, the webmaster should work towards building more through quality content and public awareness. |
HTML size | 53.2KB | Ah. Well. We were hoping for better results... We would urge the website owners to improve load speed as soon as possible. |
Website host server overview | Server status: online. Server IP address for this website is 199.34.228.55. | We apologize, but for some reason we were unable to gather enough data to provide a detailed insight at this time. |
If the basic information we presented you with above is not enough, get ready to dive in much deeper!
Now that the numbers are taken care of, we can go deeper and try to analyse the website from a user's perspective. More specifically, let's see if we can identify the target audience as well as a few related websites and categories.
Parameter | Current result | Assessment |
---|---|---|
Related categories | Regional North America United States Wisconsin Localities G Gays Mills |
The website falls into one or all of these categories, and, obviously, these are the areas of interest for the target audience. |
Alternative websites | gaysmillsorchardridge.com sunriseapples.com gaysmillsapplefestfleamarket.com kickapoo-orchard.com gaysmillslibrary.org |
These websites fall into the same categories as gaysmills.org, more or less. By extension, they compete with the analysed website for the same target audience. |
Trying to acquire very accurate visitor data is immensely difficult and can only be done when given direct access to the server. However, there are ways to get approximate numbers.
The numbers themselves probably say enough, but we'll add some insight where possible.
Parameter | Current result | Assessment |
---|---|---|
Approximate time on site | 1:47 | Pretty good for an average time spent, wouldn't you say? |
ALEXA rating is based on the number of visitors a given page receives. The higher the visitor count, the higher the rating. Currently, ALEXA has over 4 million websites indexed. If you sense cynicism in our words, you're not mistaken - we think Alexa rating is overrated, to put it mildly. A website's worth (and contextual popularity) is more than the sum of the views. So take the rank with a grain of salt.
Servers are physical storage devices that contain all the files and databases associated with a specific website, sometimes more than one. At times, a server makes up several virtual devices - separate servers used for shared hosting (tends to be cheaper). Entering website address into the address bar of your browser starts the request process during which your browser contacts the server and asks for specific files and database entries in order to display the requested website.
What follows is certainly very geeky, but informative for the knowing. Dig in:
Header detail |
---|
HTTP/1.1 200 OK Date: Thu, 23 Nov 2017 20:31:10 GMT Server: Apache Set-Cookie: is_mobile=0; path=/; domain=www.gaysmills.org Set-Cookie: language=en; expires=Thu, 07-Dec-2017 20:31:10 GMT; Max-Age=1209600; path=/ Cache-Control: private ETag: W/"a5fe24704c3c0cda902098948f8e1065" Vary: Accept-Encoding,User-Agent X-Host: pages10.sf2p.intern.weebly.net X-UA-Compatible: IE=edge,chrome=1 Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 |
Now that you are hopefully done with gaysmills.org, we invite you to read more of our in-depth reports. Try entering a new domain address in the search form at the top of this page, or on the homepage. Alternatively, refer to this list for more website overviews:
We have found so many alternative TLD extensions for gaysmills.org. Here is the full list with 580 entries:
The following list of most frequent domain address mistypes associated with gaysmills.org contains at least 1194 entries: