Look through the key statistics analysis before diving in deeper into our report:
Parameter | Current result | Assessment |
---|---|---|
Description | A center for counseling and psychotherapy for individuals, couples, and families. Also conducts groups for victims and perpetrators of domestic violence. | This meta description is 153 characters in length. Google suggests up to 320 characters at the very most to make sure the whole meta description is visible in search results page. |
Site speed | Around 0.7539 seconds | The website load speed is rather good. |
Alexa global rank | 991073, as last checked | Based on Alexa Global, we can assume the website is not very popular. Mind you, Alexa's worth is questionable at best. |
Links on homepage | Around 50 links | This is a well-judged amount of links for a homepage. |
Backlinks amount | Approximately 6 | The number of backlinks seems awfully low. If possible, the webmaster should work towards building more through quality content and public awareness. |
HTML size | 12.6KB | A very good result, this. Remember, search engines such as Google place a lot of their website ratings on its speed. |
Website host server overview | Server status: online. Server IP address for this website is 50.28.87.33. | We apologize, but for some reason we were unable to gather enough data to provide a detailed insight at this time. |
If the basic information we presented you with above is not enough, get ready to dive in much deeper!
Now that the numbers are taken care of, we can go deeper and try to analyse the website from a user's perspective. More specifically, let's see if we can identify the target audience as well as a few related websites and categories.
Parameter | Current result | Assessment |
---|---|---|
Related categories | Regional North America United States California Localities S Simi Valley Health |
The website falls into one or all of these categories, and, obviously, these are the areas of interest for the target audience. |
Alternative websites | mainstreetcounselinggroup.com attorneysocher.com cornerstoneccs.com westlakevillagefamilyservices.com cornerstonecounselingal.com |
These websites fall into the same categories as cornerstonesv.com, more or less. By extension, they compete with the analysed website for the same target audience. |
ALEXA rating is based on the number of visitors a given page receives. The higher the visitor count, the higher the rating. Currently, ALEXA has over 4 million websites indexed. If you sense cynicism in our words, you're not mistaken - we think Alexa rating is overrated, to put it mildly. A website's worth (and contextual popularity) is more than the sum of the views. So take the rank with a grain of salt.
Servers are physical storage devices that contain all the files and databases associated with a specific website, sometimes more than one. At times, a server makes up several virtual devices - separate servers used for shared hosting (tends to be cheaper). Entering website address into the address bar of your browser starts the request process during which your browser contacts the server and asks for specific files and database entries in order to display the requested website.
What follows is certainly very geeky, but informative for the knowing. Dig in:
Header detail |
---|
HTTP/1.1 200 OK Date: Thu, 22 Jun 2017 22:10:25 GMT Server: Apache/2.4.25 (Unix) OpenSSL/0.9.8e-fips-rhel5 mod_jk/1.2.37 mod_bwlimited/1.4 mod_fcgid/2.3.9 X-Powered-By: PHP/5.6.30 Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma: no-cache Set-Cookie: PHPSESSID=e093df5bffc71d483928266d4fb6bb3b; path=/ Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 |
WHOIS |
---|
Whois Server Version 2.0 Domain names in the .com and .net domains can now be registered with many different competing registrars. Go to http://www.internic.net for detailed information. Domain Name: CORNERSTONESV.COM Registrar: ENOM, INC. Sponsoring Registrar IANA ID: 48 Whois Server: whois.enom.com Referral URL: http://www.enom.com Name Server: NS1.FULL-THROTTLECOM2.NET Name Server: NS2.FULL-THROTTLECOM2.NET Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Updated Date: 11-dec-2015 Creation Date: 03-dec-2002 Expiration Date: 03-dec-2019 >>> Last update of whois database: Sun, 28 May 2017 00:11:31 GMT <<< For more information on Whois status codes, please visit https://icann.org/epp NOTICE: The expiration date displayed in this record is the date the registrar's sponsorship of the domain name registration in the registry is currently set to expire. This date does not necessarily reflect the expiration date of the domain name registrant's agreement with the sponsoring registrar. Users may consult the sponsoring registrar's Whois database to view the registrar's reported date of expiration for this registration. TERMS OF USE: You are not authorized to access or query our Whois database through the use of electronic processes that are high-volume and automated except as reasonably necessary to register domain names or modify existing registrations; the Data in VeriSign Global Registry Services' ("VeriSign") Whois database is provided by VeriSign for information purposes only, and to assist persons in obtaining information about or related to a domain name registration record. VeriSign does not guarantee its accuracy. By submitting a Whois query, you agree to abide by the following terms of use: You agree that you may use this Data only for lawful purposes and that under no circumstances will you use this Data to: (1) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via e-mail, telephone, or facsimile; or (2) enable high volume, automated, electronic processes that apply to VeriSign (or its computer systems). The compilation, repackaging, dissemination or other use of this Data is expressly prohibited without the prior written consent of VeriSign. You agree not to use electronic processes that are automated and high-volume to access or query the Whois database except as reasonably necessary to register domain names or modify existing registrations. VeriSign reserves the right to restrict your access to the Whois database in its sole discretion to ensure operational stability. VeriSign may restrict or terminate your access to the Whois database for failure to abide by these terms of use. VeriSign reserves the right to modify these terms at any time. The Registry database contains ONLY .COM, .NET, .EDU domains and Registrars. Domain Name: CORNERSTONESV.COM Registry Domain ID: 92789036_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.enom.com Registrar URL: www.enom.com Updated Date: 2010-12-09T08:03:04.00Z Creation Date: 2002-12-03T15:36:34.00Z Registrar Registration Expiration Date: 2019-12-03T20:36:00.00Z Registrar: ENOM, INC. Registrar IANA ID: 48 Domain Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited Registry Registrant ID: Registrant Name: DNR WORLDISPNETWORK.COM Registrant Organization: WORLDISPNETWORK.COM Registrant Street: 1400KENNEDYBLVD. Registrant Street: Registrant City: UNIONCITY Registrant State/Province: NJ Registrant Postal Code: 07087 Registrant Country: US Registrant Phone: +1.8668874678 Registrant Phone Ext: Registrant Fax: +1.9542522423 Registrant Fax Ext: Registrant Email: Registry Admin ID: Admin Name: DNR WORLDISPNETWORK.COM Admin Organization: WORLDISPNETWORK.COM Admin Street: 1400KENNEDYBLVD. Admin Street: Admin City: UNIONCITY Admin State/Province: NJ Admin Postal Code: 07087 Admin Country: US Admin Phone: +1.8668874678 Admin Phone Ext: Admin Fax: +1.9542522423 Admin Fax Ext: Admin Email: Registry Tech ID: Tech Name: DNR WORLDISPNETWORK.COM Tech Organization: WORLDISPNETWORK.COM Tech Street: 1400KENNEDYBLVD. Tech Street: Tech City: UNIONCITY Tech State/Province: NJ Tech Postal Code: 07087 Tech Country: US Tech Phone: +1.8668874678 Tech Phone Ext: Tech Fax: +1.9542522423 Tech Fax Ext: Tech Email: Name Server: NS1.FULL-THROTTLECOM2.NET Name Server: NS2.FULL-THROTTLECOM2.NET DNSSEC: unSigned Registrar Abuse Contact Email: Registrar Abuse Contact Phone: +1.4252982646 URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2010-12-09T08:03:04.00Z <<< For more information on Whois status codes, please visit https://icann.org/epp The data in this whois database is provided to you for information purposes only, that is, to assist you in obtaining information about or related to a domain name registration record. We make this information available "as is," and do not guarantee its accuracy. By submitting a whois query, you agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to: (1) enable high volume, automated, electronic processes that stress or load this whois database system providing you this information; or (2) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via direct mail, electronic mail, or by telephone. The compilation, repackaging, dissemination or other use of this data is expressly prohibited without prior written consent from us. We reserve the right to modify these terms at any time. By submitting this query, you agree to abide by these terms. Version 6.3 4/3/2002 Get Noticed on the Internet! Increase visibility for this domain name by listing it at www.whoisbusinesslistings.com |
Now that you are hopefully done with cornerstonesv.com, we invite you to read more of our in-depth reports. Try entering a new domain address in the search form at the top of this page, or on the homepage. Alternatively, refer to this list for more website overviews:
We have found so many alternative TLD extensions for cornerstonesv.com. Here is the full list with 580 entries:
The following list of most frequent domain address mistypes associated with cornerstonesv.com contains at least 1345 entries: