Look through the key statistics analysis before diving in deeper into our report:
Parameter | Current result | Assessment |
---|---|---|
Meta title | Cooper House | As meta title is a ranking factor, it's quite important to stick to search engine recommended length of aroun 50-60 characters. This website's meta title is 12 characters long. |
Description | A description has not been provided for this site. | This meta description is 50 characters in length. Google suggests up to 320 characters at the very most to make sure the whole meta description is visible in search results page. |
Site speed | Around 1.8212 seconds | Website ranking and usability can be greatly improved by reducing the time it takes to load it. |
Links on homepage | Around 79 links | This is a well-judged amount of links for a homepage. |
Backlinks amount | Approximately 9 | The number of backlinks seems awfully low. If possible, the webmaster should work towards building more through quality content and public awareness. |
HTML size | 130.9KB | Ah. Well. We were hoping for better results... We would urge the website owners to improve load speed as soon as possible. |
Website host server overview | Server status: online. Server IP address for this website is 198.185.159.144. | We apologize, but for some reason we were unable to gather enough data to provide a detailed insight at this time. |
If the basic information we presented you with above is not enough, get ready to dive in much deeper!
Now that the numbers are taken care of, we can go deeper and try to analyse the website from a user's perspective. More specifically, let's see if we can identify the target audience as well as a few related websites and categories.
Parameter | Current result | Assessment |
---|---|---|
Alternative websites | seattle-therapy-network.com kidsatplaytherapy.com seattletherapyservices.com rosemarywhitepediatricservices.com sbctsite.com |
These websites fall into the same categories as cooperhouse.org, more or less. By extension, they compete with the analysed website for the same target audience. |
Servers are physical storage devices that contain all the files and databases associated with a specific website, sometimes more than one. At times, a server makes up several virtual devices - separate servers used for shared hosting (tends to be cheaper). Entering website address into the address bar of your browser starts the request process during which your browser contacts the server and asks for specific files and database entries in order to display the requested website.
What follows is certainly very geeky, but informative for the knowing. Dig in:
Header detail |
---|
HTTP/1.1 200 OK Date: Tue, 14 Nov 2017 11:55:48 GMT X-ServedBy: web048 Set-Cookie: crumb=BZiLc_r95RhCZWU1OTE1YmZkNGYyNzI1MDJiM2FhYjU5MzEyOTNi;Path=/ Expires: Thu, 01 Jan 1970 00:00:00 GMT Accept-Ranges: bytes Content-Type: text/html; charset=UTF-8 X-PC-AppVer: 12418 X-PC-Date: Thu, 09 Nov 2017 02:21:51 GMT X-PC-Host: 10.122.8.22 Last-Modified: Fri, 10 Nov 2017 22:43:36 GMT X-PC-Key: h9TdNmYGsg85uLKsIkCE7IwN_ag-aliza-corrado X-PC-Hit: true Vary: Accept-Encoding, User-Agent ETag: W/"b3ce6b464460c0b6fff95b8a0115e4a5" Content-Length: 133508 x-contextid: cO6aSdMh/Rcfql888 x-via: 1.1 echo022 |
Now that you are hopefully done with cooperhouse.org, we invite you to read more of our in-depth reports. Try entering a new domain address in the search form at the top of this page, or on the homepage. Alternatively, refer to this list for more website overviews:
We have found so many alternative TLD extensions for cooperhouse.org. Here is the full list with 580 entries:
The following list of most frequent domain address mistypes associated with cooperhouse.org contains at least 1224 entries: