Look through the key statistics analysis before diving in deeper into our report:
Parameter | Current result | Assessment |
---|---|---|
Meta title | شركة كشف تسربات المياه بالرياض (الموقع للايجار | As meta title is a ranking factor, it's quite important to stick to search engine recommended length of aroun 50-60 characters. This website's meta title is 46 characters long. |
Description | شركات كشف تسربات بالرياض بأحدث وسائل مع الإصلاح بالضمان,وإصلاح تسربات المياه كشف تسربات المياه فى الرياض بدون تكسير باحدث اجهزة في كشف تسرب الماء في الجدار من | This meta description is 159 characters in length. Google suggests up to 320 characters at the very most to make sure the whole meta description is visible in search results page. |
<meta> keywords | شركة, كشف, تسربات, تسرب,ماء,بالرياض, افضل, أحدث, سائل,إصلاح, بالضمان,إصلاح, تسربات, المياه, كشفو تسربات, المياه, الرياض, بدون تكسير, باحدث, اجهزة, في, كشف تسربو الماء, في الجدار,الحمامات, السقف,الرياض, | Strangely enough, meta keywords still seem to be used. We would not go down that road unless very carefully - meta keywords have not been known as a positive ranking factor for a while now. |
Site speed | Around 5.6953 seconds | Website ranking and usability can be greatly improved by reducing the time it takes to load it. |
Alexa global rank | 977208, as last checked | Based on Alexa Global, we can assume the website is not very popular. Mind you, Alexa's worth is questionable at best. |
Links on homepage | Around 31 links | This is a well-judged amount of links for a homepage. |
Backlinks amount | Approximately 2 | The number of backlinks seems awfully low. If possible, the webmaster should work towards building more through quality content and public awareness. |
HTML size | 15.7KB | Ah. Well. We were hoping for better results... We would urge the website owners to improve load speed as soon as possible. |
Website host server overview | Server status: online. Server IP address for this website is 149.56.3.122. | We apologize, but for some reason we were unable to gather enough data to provide a detailed insight at this time. |
If the basic information we presented you with above is not enough, get ready to dive in much deeper!
ALEXA rating is based on the number of visitors a given page receives. The higher the visitor count, the higher the rating. Currently, ALEXA has over 4 million websites indexed. If you sense cynicism in our words, you're not mistaken - we think Alexa rating is overrated, to put it mildly. A website's worth (and contextual popularity) is more than the sum of the views. So take the rank with a grain of salt.
Servers are physical storage devices that contain all the files and databases associated with a specific website, sometimes more than one. At times, a server makes up several virtual devices - separate servers used for shared hosting (tends to be cheaper). Entering website address into the address bar of your browser starts the request process during which your browser contacts the server and asks for specific files and database entries in order to display the requested website.
What follows is certainly very geeky, but informative for the knowing. Dig in:
Header detail |
---|
HTTP/1.1 200 OK Server: nginx Date: Wed, 24 May 2017 17:00:06 GMT Content-Type: text/html Content-Length: 15948 Connection: keep-alive Vary: Accept-Encoding Last-Modified: Fri, 07 Oct 2016 19:37:08 GMT Expires: Wed, 24 May 2017 17:00:07 GMT Cache-Control: max-age=1 X-Cache-Status: MISS X-Server-Powered-By: Engintron Pragma: public Cache-Control: public Vary: Accept-Encoding Accept-Ranges: bytes |
WHOIS |
---|
Whois Server Version 2.0 Domain names in the .com and .net domains can now be registered with many different competing registrars. Go to http://www.internic.net for detailed information. Domain Name: COMPANYDETECTLEAKSWATERINRIYADH.COM Registrar: GODADDY.COM, LLC Sponsoring Registrar IANA ID: 146 Whois Server: whois.godaddy.com Referral URL: http://www.godaddy.com Name Server: NS1.NAKLAFSH.COM Name Server: NS2.NAKLAFSH.COM Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited Updated Date: 09-dec-2016 Creation Date: 05-oct-2016 Expiration Date: 05-oct-2017 >>> Last update of whois database: Sat, 27 May 2017 16:25:13 GMT <<< For more information on Whois status codes, please visit https://icann.org/epp NOTICE: The expiration date displayed in this record is the date the registrar's sponsorship of the domain name registration in the registry is currently set to expire. This date does not necessarily reflect the expiration date of the domain name registrant's agreement with the sponsoring registrar. Users may consult the sponsoring registrar's Whois database to view the registrar's reported date of expiration for this registration. TERMS OF USE: You are not authorized to access or query our Whois database through the use of electronic processes that are high-volume and automated except as reasonably necessary to register domain names or modify existing registrations; the Data in VeriSign Global Registry Services' ("VeriSign") Whois database is provided by VeriSign for information purposes only, and to assist persons in obtaining information about or related to a domain name registration record. VeriSign does not guarantee its accuracy. By submitting a Whois query, you agree to abide by the following terms of use: You agree that you may use this Data only for lawful purposes and that under no circumstances will you use this Data to: (1) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via e-mail, telephone, or facsimile; or (2) enable high volume, automated, electronic processes that apply to VeriSign (or its computer systems). The compilation, repackaging, dissemination or other use of this Data is expressly prohibited without the prior written consent of VeriSign. You agree not to use electronic processes that are automated and high-volume to access or query the Whois database except as reasonably necessary to register domain names or modify existing registrations. VeriSign reserves the right to restrict your access to the Whois database in its sole discretion to ensure operational stability. VeriSign may restrict or terminate your access to the Whois database for failure to abide by these terms of use. VeriSign reserves the right to modify these terms at any time. The Registry database contains ONLY .COM, .NET, .EDU domains and Registrars. Domain Name: companydetectleakswaterinriyadh.com Registrar URL: http://www.godaddy.com Registrant Name: HoStY-HoSt.CoM EG Registrant Organization: HoStY-HoSt.CoM.EG Name Server: NS1.NAKLAFSH.COM Name Server: NS2.NAKLAFSH.COM DNSSEC: unsigned For complete domain details go to: http://who.godaddy.com/whoischeck.aspx?domain=companydetectleakswaterinriyadh.com The data contained in GoDaddy.com, LLC's WhoIs database, while believed by the company to be reliable, is provided "as is" with no guarantee or warranties regarding its accuracy. This information is provided for the sole purpose of assisting you in obtaining information about domain name registration records. Any use of this data for any other purpose is expressly forbidden without the prior written permission of GoDaddy.com, LLC. By submitting an inquiry, you agree to these terms of usage and limitations of warranty. In particular, you agree not to use this data to allow, enable, or otherwise make possible, dissemination or collection of this data, in part or in its entirety, for any purpose, such as the transmission of unsolicited advertising and and solicitations of any kind, including spam. You further agree not to use this data to enable high volume, automated or robotic electronic processes designed to collect or compile this data for any purpose, including mining this data for your own personal or commercial purposes. Please note: the registrant of the domain name is specified in the "registrant" section. In most cases, GoDaddy.com, LLC is not the registrant of domain names listed in this database. |
Now that you are hopefully done with companydetectleakswaterinriyadh.com, we invite you to read more of our in-depth reports. Try entering a new domain address in the search form at the top of this page, or on the homepage. Alternatively, refer to this list for more website overviews:
We have found so many alternative TLD extensions for companydetectleakswaterinriyadh.com. Here is the full list with 580 entries:
The following list of most frequent domain address mistypes associated with companydetectleakswaterinriyadh.com contains at least 1210 entries: