Look through the key statistics analysis before diving in deeper into our report:
| Parameter | Current result | Assessment |
|---|---|---|
| Meta title | Vehicle Tracking GPS System | Car Fleet Tracker | The Black Box | As meta title is a ranking factor, it's quite important to stick to search engine recommended length of aroun 50-60 characters. This website's meta title is 63 characters long. |
| Description | The Black Box introduces the best GPS tracking solutions with live reporting and total remote control in your hand. Vehicle tracking system for Cars, Motocycle bikes, fleets and construction equipment and utilities. TheBlackBox.in also offers GPS tracker solution for Kids tracking, Employee tracking, Material tracking, Equipment tracking, Asset tracking and Elders tracking. | This meta description is 376 characters in length. Google suggests up to 320 characters at the very most to make sure the whole meta description is visible in search results page. |
| <meta> keywords | vehicle tracking system, gps system, vehicle tracking, car tracker, car gps tracker, bike tracker, fleet tracking, bike gps tracker, vehicle tracking software, vehicle tracker india, www.theblackbox.in, theblackbox.in, gps the black box, the black box gps system | Strangely enough, meta keywords still seem to be used. We would not go down that road unless very carefully - meta keywords have not been known as a positive ranking factor for a while now. |
| Site speed | Around 0.5121 seconds | The website load speed is rather good. |
| Alexa global rank | 7858003, as last checked | Based on Alexa Global, we can assume the website is not very popular. Mind you, Alexa's worth is questionable at best. |
| Links on homepage | Around 28 links | This is a well-judged amount of links for a homepage. |
| Backlinks amount | Approximately 1 | The number of backlinks seems awfully low. If possible, the webmaster should work towards building more through quality content and public awareness. |
| HTML size | 12KB | A very good result, this. Remember, search engines such as Google place a lot of their website ratings on its speed. |
| Website host server overview | Server status: online. Server IP address for this website is 160.153.71.168. | We apologize, but for some reason we were unable to gather enough data to provide a detailed insight at this time. |
If the basic information we presented you with above is not enough, get ready to dive in much deeper!
Now that the numbers are taken care of, we can go deeper and try to analyse the website from a user's perspective. More specifically, let's see if we can identify the target audience as well as a few related websites and categories.
| Parameter | Current result | Assessment |
|---|---|---|
| Alternative websites | trackmaster.in hitecpoint.in blackboxgps.com pumaguard.com gpsvehicletrackingsystemindia.wordpress.com |
These websites fall into the same categories as theblackbox.in, more or less. By extension, they compete with the analysed website for the same target audience. |
Trying to acquire very accurate visitor data is immensely difficult and can only be done when given direct access to the server. However, there are ways to get approximate numbers.
The numbers themselves probably say enough, but we'll add some insight where possible.
| Parameter | Current result | Assessment |
|---|---|---|
| Approximate time on site | 2:05 | Pretty good for an average time spent, wouldn't you say? |
ALEXA rating is based on the number of visitors a given page receives. The higher the visitor count, the higher the rating. Currently, ALEXA has over 4 million websites indexed. If you sense cynicism in our words, you're not mistaken - we think Alexa rating is overrated, to put it mildly. A website's worth (and contextual popularity) is more than the sum of the views. So take the rank with a grain of salt.
Servers are physical storage devices that contain all the files and databases associated with a specific website, sometimes more than one. At times, a server makes up several virtual devices - separate servers used for shared hosting (tends to be cheaper). Entering website address into the address bar of your browser starts the request process during which your browser contacts the server and asks for specific files and database entries in order to display the requested website.
What follows is certainly very geeky, but informative for the knowing. Dig in:
| Header detail |
|---|
HTTP/1.1 200 OK Date: Wed, 29 Nov 2017 22:56:50 GMT Server: Apache Last-Modified: Wed, 07 Sep 2016 16:31:46 GMT ETag: "b5c1f04-2fc9-53bed730b5a1c" Accept-Ranges: bytes Content-Length: 12233 Vary: Accept-Encoding,User-Agent Content-Type: text/html |
| WHOIS |
|---|
Access to .IN WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the .IN registry database. The data in this record is provided by .IN Registry for informational purposes only, and .IN does not guarantee its accuracy. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to: (a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator, a Registrar, or Afilias except as reasonably necessary to register domain names or modify existing registrations. All rights reserved. .IN reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy. Domain ID:D9196819-AFIN Domain Name:THEBLACKBOX.IN Created On:14-Feb-2015 12:29:03 UTC Last Updated On:26-Dec-2016 04:10:00 UTC Expiration Date:14-Feb-2019 12:29:03 UTC Sponsoring Registrar:GoDaddy.com, LLC (R101-AFIN) Status:CLIENT DELETE PROHIBITED Reason: Status:CLIENT RENEW PROHIBITED Reason: Status:CLIENT TRANSFER PROHIBITED Reason: Status:CLIENT UPDATE PROHIBITED Reason: Registrant ID:CR187818707 Registrant Name:The Black Box Registrant Organization:The Black Box Registrant Street1:GIDC Registrant Street2:Matar Registrant Street3: Registrant City:Kheda Registrant State/Province:Gujarat Registrant Postal Code:382000 Registrant Country:IN Registrant Phone:+91.9909911898 Registrant Phone Ext.: Registrant FAX: Registrant FAX Ext.: Registrant Email: Admin ID:CR187818709 Admin Name:The Black Box Admin Organization:The Black Box Admin Street1:GIDC Admin Street2:Matar Admin Street3: Admin City:Kheda Admin State/Province:Gujarat Admin Postal Code:382000 Admin Country:IN Admin Phone:+91.9909911898 Admin Phone Ext.: Admin FAX: Admin FAX Ext.: Admin Email: Tech ID:CR187818708 Tech Name:The Black Box Tech Organization:The Black Box Tech Street1:GIDC Tech Street2:Matar Tech Street3: Tech City:Kheda Tech State/Province:Gujarat Tech Postal Code:382000 Tech Country:IN Tech Phone:+91.9909911898 Tech Phone Ext.: Tech FAX: Tech FAX Ext.: Tech Email: Name Server:NS29.DOMAINCONTROL.COM Name Server:NS30.DOMAINCONTROL.COM Name Server: Name Server: Name Server: Name Server: Name Server: Name Server: Name Server: Name Server: Name Server: Name Server: Name Server: DNSSEC:Unsigned |
Now that you are hopefully done with theblackbox.in, we invite you to read more of our in-depth reports. Try entering a new domain address in the search form at the top of this page, or on the homepage. Alternatively, refer to this list for more website overviews:
We have found so many alternative TLD extensions for theblackbox.in. Here is the full list with 580 entries:
The following list of most frequent domain address mistypes associated with theblackbox.in contains at least 1302 entries: